Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae ATP synthase subunit a (atpB)

This Recombinant Streptococcus pneumoniae ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

C1CF98

Expression Region

1-238

Origin

Streptococcus pneumoniae (strain JJA)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNVLEYVYDFV IGFTEPNIGSRYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLT LSFLVILLTHIESVRRRGFKKSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEV MTSLLLLLSHQAIYWYPVAFGANLAWTAFSVFISCIQAYVFTLLTSVYLGNKINIEEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,1-Difluorocyclopropane-1-dibenzosuberyl Piperazine Trifluoroacetic Acid Salt
TRC-D445670-5MG 5 mg

1,1-Difluorocyclopropane-1-dibenzosuberyl Piperazine Trifluoroacetic Acid Salt

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS712771 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
P4HA2 (NM_001017973) Human Over-expression Lysate
LY422630 100 µg

P4HA2 (NM_001017973) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant HCoV-229E S1 Protein (His Tag)
PKSV030116 100 µg

Recombinant HCoV-229E S1 Protein (His Tag)

Sign In for Pricing
View Details
Claudin 7 (Ab-210) Antibody
8B8321-AAT 50 µg

Claudin 7 (Ab-210) Antibody

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2789), 0.2mg/mL
BNUB2789-100 1x 100 µL

CD63 (Late Endosomes Marker) (LAMP3/2789), 0.2mg/mL

Sign In for Pricing
View Details