Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Papio anubis Dolichyldiphosphatase 1 (DOLPP1)

This Recombinant Papio anubis Dolichyldiphosphatase 1 (DOLPP1) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Dolichyldiphosphatase 1, EC= 3.6.1.43, Dolichyl pyrophosphate phosphatase 1

UniProt

B0CM95

Expression Region

1-238

Origin

Papio anubis (Olive baboon)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLIIFKRELHTI SFLGGLALNEGVNWLIKNVIQEPRPCGGPHTAVGTKYGMPSSHSQFMWFFSIYSFLFLYL RMHQTNNARFLDLLWRHVLSLGLLAAAFLVSYSRVYLLYHTWSQVLYGGIAGGLMAIAWF IFTQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL-6/Interleukin-6 Protein
PKSH033611-01 20 µg

Recombinant Human IL-6/Interleukin-6 Protein

Sign In for Pricing
View Details
Recombinant Human IL-6/Interleukin-6 Protein
PKSH033611-02 100 µg

Recombinant Human IL-6/Interleukin-6 Protein

Sign In for Pricing
View Details
Recombinant Human SPARC Protein (Trx Tag)
PDEH100650-01 20 µg

Recombinant Human SPARC Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human SPARC Protein (Trx Tag)
PDEH100650-02 100 µg

Recombinant Human SPARC Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human SPARC Protein (Trx Tag)
PDEH100650-03 500 µg

Recombinant Human SPARC Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human SPARC Protein (Trx Tag)
PDEH100650-04 1 mg

Recombinant Human SPARC Protein (Trx Tag)

Sign In for Pricing
View Details