Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Papio anubis Dolichyldiphosphatase 1 (DOLPP1)

This Recombinant Papio anubis Dolichyldiphosphatase 1 (DOLPP1) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Dolichyldiphosphatase 1, EC= 3.6.1.43, Dolichyl pyrophosphate phosphatase 1

UniProt

B0CM95

Expression Region

1-238

Origin

Papio anubis (Olive baboon)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLIIFKRELHTI SFLGGLALNEGVNWLIKNVIQEPRPCGGPHTAVGTKYGMPSSHSQFMWFFSIYSFLFLYL RMHQTNNARFLDLLWRHVLSLGLLAAAFLVSYSRVYLLYHTWSQVLYGGIAGGLMAIAWF IFTQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Iodo-2’-deoxytubercidin
TRC-I705030-50MG 50 mg

5-Iodo-2’-deoxytubercidin

Sign In for Pricing
View Details
CD31 (PECAM1) (NM_000442) Human Recombinant Protein
TP308654L 1 mg

CD31 (PECAM1) (NM_000442) Human Recombinant Protein

Sign In for Pricing
View Details
Human UNC5A activation kit by CRISPRa
GA113993 1 Kit

Human UNC5A activation kit by CRISPRa

Sign In for Pricing
View Details
Prefilled 2.0ml tubes, Zirconium Beads, 0.1mm Triple-Pure - High Impact, 50pk
D1032-01 1 Each

Prefilled 2.0ml tubes, Zirconium Beads, 0.1mm Triple-Pure - High Impact, 50pk

Sign In for Pricing
View Details
SAP18 (Center) Rabbit Polyclonal Antibody
AP53795PU-N 400 µL

SAP18 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Storage Box
R1020-B 5 Units/Pack

Storage Box

Sign In for Pricing
View Details