Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Outer membrane protein A (ompA)

This Recombinant Outer membrane protein A (ompA) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Outer membrane protein A, Outer membrane protein II

UniProt

P24016

Expression Region

1-238

Origin

Citrobacter freundii

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LTAKLGYPITDDLDIYTRLGGMVWRADAKNNEGFKDHDTGVSPVFAGGVEYAITPEIATR LEYQWTNNIGDANTVGGRPDNGLLSVGVSYRFGQQEEAAPVVVAPAPAPEVQTKHFTLKS DVLFNFNKATLKPEGQQALDQMYSQLSNLDPKDGSVVVLGFTDRIGSDAYNQGLSEKRAQ SVVDYLISKGIPSDKISARGMGESNPVTGNTCDNVKARAALIDCLAPDRRVEIEVKGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD174 Blocking Peptide
MBS823983-01 1 mg

CD174 Blocking Peptide

Sign In for Pricing
View Details
CD174 Blocking Peptide
MBS823983-02 5 mg

CD174 Blocking Peptide

Sign In for Pricing
View Details
CD174 Blocking Peptide
MBS823983-03 5x 5 mg

CD174 Blocking Peptide

Sign In for Pricing
View Details
Recombinant Human CD70
232370 100 µg

Recombinant Human CD70

Sign In for Pricing
View Details
MMP1 (Matrix Metalloproteinase 1, CLGN, CLG1, Collagenase, Interstitial Collagenase, Vertebrate Collagenase, Fibroblast Collagenase)
364165 200 µL

MMP1 (Matrix Metalloproteinase 1, CLGN, CLG1, Collagenase, Interstitial Collagenase, Vertebrate Collagenase, Fibroblast Collagenase)

Sign In for Pricing
View Details
GNB1 Polyclonal Antibody
MBS2518382-01 0.02 mL

GNB1 Polyclonal Antibody

Sign In for Pricing
View Details