Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Electron transport complex protein RnfE (rnfE)

This Recombinant Pseudomonas aeruginosa Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-239.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

A6V1T4

Expression Region

1-239

Origin

Pseudomonas aeruginosa (strain PA7)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEQGLREIARDGLWRNNPGLVQLLGLCPLLGTSNSTVNALGLGLATLLVLVCSNAAVSL VRGAVSEAIRLPAFVMIIAALTTCIELLMQAWTYELYQILGIFIPLITTNCVILGRAEAF AAKNGVLRASFDGLLTGLGFALVLLVLGGLRELLGQGTLLADMQLLFGPAAETWKIQIFP HYQGFLLAILPPGAFIMLGLLIALKNRIDESLAERARAQAGDVPASPQRQRVRVTGVIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RAB3C activation kit by CRISPRa
GA114550 1 Kit

Human RAB3C activation kit by CRISPRa

Sign In for Pricing
View Details
Ancient ubiquitous protein 1 (AUP1) Human Gene Knockout Kit (CRISPR)
KN422822 1 Kit

Ancient ubiquitous protein 1 (AUP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Hip
CS706926 5x 5 µm

Tissue FFPE Sections, Hip

Sign In for Pricing
View Details
Cyclopropylhydrazine Dihydrochloride
TRC-C982505-250MG 250 mg

Cyclopropylhydrazine Dihydrochloride

Sign In for Pricing
View Details
MSK2 (Ab-568) Antibody
8B8149-AAT 50 µg

MSK2 (Ab-568) Antibody

Sign In for Pricing
View Details
MMP16 (C-term) Rabbit Polyclonal Antibody
AP23329PU-N 100 µg

MMP16 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details