Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Electron transport complex protein RnfE (rnfE)

This Recombinant Pseudomonas aeruginosa Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-239.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

A6V1T4

Expression Region

1-239

Origin

Pseudomonas aeruginosa (strain PA7)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEQGLREIARDGLWRNNPGLVQLLGLCPLLGTSNSTVNALGLGLATLLVLVCSNAAVSL VRGAVSEAIRLPAFVMIIAALTTCIELLMQAWTYELYQILGIFIPLITTNCVILGRAEAF AAKNGVLRASFDGLLTGLGFALVLLVLGGLRELLGQGTLLADMQLLFGPAAETWKIQIFP HYQGFLLAILPPGAFIMLGLLIALKNRIDESLAERARAQAGDVPASPQRQRVRVTGVIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant MCM7 Antibody
RC-6994-01 50 μL

Recombinant MCM7 Antibody

Sign In for Pricing
View Details
Recombinant MCM7 Antibody
RC-6994-02 100 µL

Recombinant MCM7 Antibody

Sign In for Pricing
View Details
Recombinant MCM7 Antibody
RC-6994-03 1 mL

Recombinant MCM7 Antibody

Sign In for Pricing
View Details
Ivacaftor Carboxylic Acid
TRC-I940605-1MG 1 mg

Ivacaftor Carboxylic Acid

Sign In for Pricing
View Details
RAP1GDS1 (NM_001100427) Human Recombinant Protein
TP312781 20 µg

RAP1GDS1 (NM_001100427) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS711556 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details