Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Derlin-2 (DERL2)

This Recombinant Pongo abelii Derlin-2 (DERL2) spans the amino acid sequence from region 1-239.

Product Specifications

Product Name Alternative

Derlin-2, Degradation in endoplasmic reticulum protein 2, Der1-like protein 2

UniProt

Q5RC74

Expression Region

1-239

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITN FLFFGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLVFL GQAFTIMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGH IYFFLEDVFPNQPGGIRILKTPSILKAIFDTPDEDPNYNPLPEERPGGFAWGEGQRLGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-LIMK1 Antibody
STJ501610 100 µg

Anti-LIMK1 Antibody

Sign In for Pricing
View Details
RIP Rabbit Monoclonal antibody
AMRe03794-01 1 Each

RIP Rabbit Monoclonal antibody

Sign In for Pricing
View Details
RIP Rabbit Monoclonal antibody
AMRe03794-02 50 µL

RIP Rabbit Monoclonal antibody

Sign In for Pricing
View Details
RIP Rabbit Monoclonal antibody
AMRe03794-03 100 µL

RIP Rabbit Monoclonal antibody

Sign In for Pricing
View Details
DSPE-PEG-VTLTYEFAAGPRD
MPL0775K Each

DSPE-PEG-VTLTYEFAAGPRD

Sign In for Pricing
View Details
CELF2 Protein Vector (Mouse) (pPM-C-His)
PV164537 500 ng

CELF2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details