What sizes are available for Recombinant ATP synthase subunit a, chloroplastic (atpI)?

Recombinant ATP synthase subunit a, chloroplastic (atpI) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant ATP synthase subunit a, chloroplastic (atpI) come in?

Recombinant ATP synthase subunit a, chloroplastic (atpI) is available in 2 different pack sizes.

Recombinant ATP synthase subunit a, chloroplastic (atpI)

Q: What is the catalog number for Recombinant ATP synthase subunit a, chloroplastic (atpI)?

The catalog number for Recombinant ATP synthase subunit a, chloroplastic (atpI) is orb2917349.

This Recombinant ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-239.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q9TM31

Expression Region

1-239

Origin

Cyanidium caldarium

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISNNLEICSIDIGVHWYWNFLGLKIHGQVLLVSWVAIIILLLLAILGTFNMQKEPRGFQ NFLEYVFEFLQDISKNQIEEKYYKSWVPFISTLFLFIFVSNWLGALVPWKLIKIPEGELA APTNDINTTVALAMLTSVSYFYAGLSKKGLRYFLKYISPTPILLPINILEDFTKPLSLSF RLFGNIVADELVVAVFNLLFPLFLPLPVMVLGLFASSIQALIFATLSASYIGESLADHH