Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nephroselmis olivacea ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Nephroselmis olivacea ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-239.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q9TL13

Expression Region

1-239

Origin

Nephroselmis olivacea (Green alga)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYAMNPLYDMCAVEVGQHYYWLIAGYQVHAQVLITSWFVIGFLLIGCFVASRNLQEIPEG GQNFLEYVLEFIRDLAKTQIGHESRKWVPYLGTLFLFIFVSNWSGALVPWRLIELPNGEL GAPTADINTTVALALMTSTAYFYAGLTKKGFGYFSKYLKPTPILLPINILEDFTKPLSLS FRLFGNVLADELVVAVLISLVPLVVPIPMMLLGLFAGAIQSLIFATLAGAYIGEALEGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DENND3 (NM_014957) Human Over-expression Lysate
LY402395 100 µg

DENND3 (NM_014957) Human Over-expression Lysate

Sign In for Pricing
View Details
t-Butyl (3R,5S)-7-[2-Cyclopropyl-4-(4-fluorophenyl)quinolin-3-yl]-3,5-isopropylidenedioxy-6-heptenoate
TRC-B689830-250MG 250 mg

t-Butyl (3R,5S)-7-[2-Cyclopropyl-4-(4-fluorophenyl)quinolin-3-yl]-3,5-isopropylidenedioxy-6-heptenoate

Sign In for Pricing
View Details
Fmoc-Asn (Trt) Wang Resin
H0370751304.5G 5 g

Fmoc-Asn (Trt) Wang Resin

Sign In for Pricing
View Details
5-Amino-2-mercaptobenzimidazole
TRC-A576965-1G 1 g

5-Amino-2-mercaptobenzimidazole

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS700600 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
EXOC6B Rabbit Polyclonal Antibody
TA363609 100 µL

EXOC6B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details