Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Derlin-2 (DERL2)

This Recombinant Human Derlin-2 (DERL2) spans the amino acid sequence from region 1-239.

Product Specifications

Product Name Alternative

Derlin-2, Degradation in endoplasmic reticulum protein 2, DERtrin-2, Der1-like protein 2, F-LAN-1, F-LANa

UniProt

Q9GZP9

Expression Region

1-239

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITN FLFFGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLVFL GQAFTIMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGH IYFFLEDVFPNQPGGIRILKTPSILKAIFDTPDEDPNYNPLPEERPGGFAWGEGQRLGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFSF10 ELISA Kit (Mouse) (OKCD09516)
OKCD09516 96 Well

TNFSF10 ELISA Kit (Mouse) (OKCD09516)

Sign In for Pricing
View Details
ID4 Rabbit Polyclonal Antibody
TA351275 100 µL

ID4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDC45L, ID (CDC45, CDC45L, CDC45L2, Cell division control protein 45 homolog, PORC-PI-1) (APC) discontinued
033603-APC 200 µL

CDC45L, ID (CDC45, CDC45L, CDC45L2, Cell division control protein 45 homolog, PORC-PI-1) (APC) discontinued

Sign In for Pricing
View Details
RPL6P27 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV775105 1.0 µg DNA

RPL6P27 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
ZNF76 (NM_003427) Human Tagged Lenti ORF Clone
RC200399L4 10 µg

ZNF76 (NM_003427) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human CAMK2B (NM_172079) AAV Particle
RC218194A1V 250 µL

Human CAMK2B (NM_172079) AAV Particle

Sign In for Pricing
View Details