Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetraspanin-9 (TSPAN9)

This Recombinant Human Tetraspanin-9 (TSPAN9) spans the amino acid sequence from region 1-239.

Product Specifications

Product Name Alternative

Tetraspanin-9, Tspan-9, Tetraspan NET-5

UniProt

O75954

Expression Region

1-239

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MARGCLCCLKYMMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFSPSFPSLSAANLVIAI GTIVMVTGFLGCLGAIKENKCLLLSFFIVLLVILLAELILLILFFVYMDKVNENAKKDLK EGLLLYHTENNVGLKNAWNIIQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGCGRN ATTPLWRTGCYEKVKMWFDDNKHVLGTVGMCILIMQILGMAFSMTLFQHIHRTGKKYDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,3-Bis[2-(2,4-dinitrophenyl)hydrazone]2,3-pentanedione
TRC-B592203-1G 1 g

2,3-Bis[2-(2,4-dinitrophenyl)hydrazone]2,3-pentanedione

Sign In for Pricing
View Details
Human C6orf211 (ARMT1) activation kit by CRISPRa
GA112496 1 Kit

Human C6orf211 (ARMT1) activation kit by CRISPRa

Sign In for Pricing
View Details
ERBB2 Antibody
KC-3042-01 50 μL

ERBB2 Antibody

Sign In for Pricing
View Details
ERBB2 Antibody
KC-3042-02 100 µL

ERBB2 Antibody

Sign In for Pricing
View Details
ERBB2 Antibody
KC-3042-03 1 mL

ERBB2 Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR562359 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details