Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit a (atpB)

This Recombinant Synechococcus sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-239.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A5GV77

Expression Region

1-239

Origin

Synechococcus sp. (strain RCC307)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLHLPLAELEVGHHLYWQIGNLNIHGQVFLSSWIVIGALLAVVVLGTRKMERDPRGVQN LLEFLWDYLRDLARDQIGEKVYRDWLPFIGTLFLFIFVSNWGGALIPWRIVHLPSGELGA PTADINTTVAMALLVSLAFFYAGLSNKGLKFFEYYVEPTPIMLPFKIIEEFTKPLSLSFR LFGNILADELAVAVLASLVPLLVPLPVMLLGLFTSAIQALIFATLAAFYIGEAVHEEAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,6-Diaminopurine Arabinoside
TRC-D416738-5G 5 g

2,6-Diaminopurine Arabinoside

Sign In for Pricing
View Details
Cdcp3 Mouse Gene Knockout Kit (CRISPR)
KN500468 1 Kit

Cdcp3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human MMP-2 Protein (His Tag)
PDMH100465-01 20 µg

Recombinant Human MMP-2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human MMP-2 Protein (His Tag)
PDMH100465-02 100 µg

Recombinant Human MMP-2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human MMP-2 Protein (His Tag)
PDMH100465-03 500 µg

Recombinant Human MMP-2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human MMP-2 Protein (His Tag)
PDMH100465-04 1 mg

Recombinant Human MMP-2 Protein (His Tag)

Sign In for Pricing
View Details