Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Cobalamin synthase (cobS)

This Recombinant Pseudomonas putida Cobalamin synthase (cobS) spans the amino acid sequence from region 1-240.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B0KT69

Expression Region

1-240

Origin

Pseudomonas putida (strain GB-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPFLIALQFLSSLPVSLPGMPAAREVGRSLLYYPLVGLLFGLLLWLASHLLQGTPAPLH AALLLTAWVLLSGALHLDGLADSADAWLGGFGDRERTLQIMKDPRSGPIAVVTLVLVLLL KFCALWVLVEQGVGAQLLLAPLIGRTAMLGLFLCTPYVRPGGLGQALAEHLPRRAAGWVL LCCALFCLLLGGWVVLLAVAVFAWLRHLMYRRLGGATGDTAGALLELLELAVVLGLALGL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-CHD8 IHC Antibody, Affinity Purified
IHC-00246-T 0.5 µg

Rabbit anti-CHD8 IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
Goat Interleukin 28B ELISA Kit
MBS086338 Inquire

Goat Interleukin 28B ELISA Kit

Sign In for Pricing
View Details
RBP2, ID (RBP2, CRBP2, Retinol-binding protein 2, Cellular retinol-binding protein II) (AP)
MBS6340916-01 0.2 mL

RBP2, ID (RBP2, CRBP2, Retinol-binding protein 2, Cellular retinol-binding protein II) (AP)

Sign In for Pricing
View Details
RBP2, ID (RBP2, CRBP2, Retinol-binding protein 2, Cellular retinol-binding protein II) (AP)
MBS6340916-02 5x 0.2 mL

RBP2, ID (RBP2, CRBP2, Retinol-binding protein 2, Cellular retinol-binding protein II) (AP)

Sign In for Pricing
View Details
Tsp23 Antibody: HRP
MBS801974-01 0.1 mg

Tsp23 Antibody: HRP

Sign In for Pricing
View Details
Tsp23 Antibody: HRP
MBS801974-02 5x 0.1 mg

Tsp23 Antibody: HRP

Sign In for Pricing
View Details