Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Cobalamin synthase (cobS)

This Recombinant Pseudomonas putida Cobalamin synthase (cobS) spans the amino acid sequence from region 1-240.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q88M93

Expression Region

1-240

Origin

Pseudomonas putida (strain KT2440)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPFWIALQFLSSLPVSLPGMPAPREVGRSLLYYPLVGLLFGLLLWLASHLLQGTPSPLH AALLLTLWVLLSGALHLDGLADSADAWLGGFGDRERTLRIMKDPRSGPIAVVTLVLVLLL KFCALWVLVGQGIGAQLLLAPLIGRAAMLGLFLCTPYVRPGGLGQALAEHMPRRAAGWVL LVCVLFCLFLGGWSVLLALAVFAWLRHLMCRRLGGTTGDTAGALLELLELAVVLGLALGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR4A3 (Nuclear Receptor Subfamily 4, Group A, Member 3, CHN, CSMF, MINOR, NOR1, TEC) (Biotin)
MBS6171005-01 0.1 mL

NR4A3 (Nuclear Receptor Subfamily 4, Group A, Member 3, CHN, CSMF, MINOR, NOR1, TEC) (Biotin)

Sign In for Pricing
View Details
NR4A3 (Nuclear Receptor Subfamily 4, Group A, Member 3, CHN, CSMF, MINOR, NOR1, TEC) (Biotin)
MBS6171005-02 5x 0.1 mL

NR4A3 (Nuclear Receptor Subfamily 4, Group A, Member 3, CHN, CSMF, MINOR, NOR1, TEC) (Biotin)

Sign In for Pricing
View Details
NVR 3-778
A9955-10 10 mg

NVR 3-778

Sign In for Pricing
View Details
SLC17A6 Antibody
MBS9430439-01 0.1 mL

SLC17A6 Antibody

Sign In for Pricing
View Details
SLC17A6 Antibody
MBS9430439-02 5x 0.1 mL

SLC17A6 Antibody

Sign In for Pricing
View Details
G6PDH Rabbit Polyclonal Antibody (RBITC)
orb1034347 100 µL

G6PDH Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details