Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oceanobacillus iheyensis ATP synthase subunit a (atpB)

This Recombinant Oceanobacillus iheyensis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-240.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q8EM77

Expression Region

1-240

Origin

Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHENPIVHDIFGIPGANLNLSNLMMTFIVCLIVFVFCVWGSRKLQMKPKGIQNFMEWAV EFVRGIIQDNMDWKTGRIFLPLGLTLIFYILVSNLIGVATVGVVEHDLWWKSPTADAVMT LTLSTMIIALTHYYGIKLRGTKAYLKTYVSPVPLMLPFKIVEEFTNTLTLGLRLFGNIYA GEILLSLLVGLATTSIFGFFGAALPMLAWQTFSVFIGAIQSYVFVMLTMVYMSHKVSSDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calmegin (CLGN) (NM_001130675) Human Over-expression Lysate
LY427232 100 µg

Calmegin (CLGN) (NM_001130675) Human Over-expression Lysate

Sign In for Pricing
View Details
PARK7 Antibody
KC-799-01 50 μL

PARK7 Antibody

Sign In for Pricing
View Details
PARK7 Antibody
KC-799-02 100 µL

PARK7 Antibody

Sign In for Pricing
View Details
PARK7 Antibody
KC-799-03 1 mL

PARK7 Antibody

Sign In for Pricing
View Details
Recombinant EGFR (phospho Y1086) Antibody
RC-16349-01 50 μL

Recombinant EGFR (phospho Y1086) Antibody

Sign In for Pricing
View Details
Recombinant EGFR (phospho Y1086) Antibody
RC-16349-02 100 µL

Recombinant EGFR (phospho Y1086) Antibody

Sign In for Pricing
View Details