Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macrococcus caseolyticus ATP synthase subunit a (atpB)

This Recombinant Macrococcus caseolyticus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-240.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B9E8F1

Expression Region

1-240

Origin

Macrococcus caseolyticus (strain JCSC5402)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGHESPLYSLDLFGHEMIFDLSSMLMLTVTAAIVFLIAMLFTRNLSVRPHGKQNFIEWIF DFTRGIINSNMAWNKGGRFHFLAVTLLLFIFVANMLGLPFAIINGHTLWWKSPTADPTVT LTLSTLMVLLTHFYGVKMRGTGNYLKSFAQPVWFMVPFKIIEEFSSTLTLGLRLYGNIFA GEVLLGLLATLGTAGAAGMLGAAIPTLIWQGFSIFVGSIQAYIFVMLSMVYMSHKVSDDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isophrymarol acetate
TN6175 5 mg

Isophrymarol acetate

Sign In for Pricing
View Details
Fabric mantle for 2000ml metal beaker, 550W, 115V
100A O632 1 Each

Fabric mantle for 2000ml metal beaker, 550W, 115V

Sign In for Pricing
View Details
Human PSAP (Prosaposin) ELISA Kit
EH25196 96 Tests

Human PSAP (Prosaposin) ELISA Kit

Sign In for Pricing
View Details
Mouse Clxn Pre-designed siRNA Set B
SI102760B 1 Each

Mouse Clxn Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human vWF-A2 (ADAMTS13-cleaved) MAb (Clone 490628)
MAB27642 100 µg

Human vWF-A2 (ADAMTS13-cleaved) MAb (Clone 490628)

Sign In for Pricing
View Details
Mouse Podoplanin (PDPN) Protein
abx694266-01 20 µg

Mouse Podoplanin (PDPN) Protein

Sign In for Pricing
View Details