Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable Ni/Fe-hydrogenase B-type cytochrome subunit (hoxZ)

This Recombinant Probable Ni/Fe-hydrogenase B-type cytochrome subunit (hoxZ) spans the amino acid sequence from region 1-240.

Product Specifications

Product Name Alternative

Probable Ni/Fe-hydrogenase B-type cytochrome subunit

UniProt

P23000

Expression Region

1-240

Origin

Azotobacter vinelandii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALEKSLETGDGQEKVRKQTAVYVYEAPLRLWHWVTALSIVVLGVTGYFIGAPLPTMPGE AMDNYLMGYIRFAHFAAGYVLAIGFLGRVYWAFVGNHHARELFLVPVHRKAWWKELWHEV RWYLFLEKTPKKYIGHNPLGQLAMFCFFVVGAVFMSVTGFALYAEGLGRDSWADRLFGWV IPLFGQSQDVHTWHHLGMWYLVVFVMVHVYLAVREDIVSRQSLISTMVGGWRMFKDDRPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL
BNC400039-500 1x 500 µL

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF740 conjugate, 0.1mg/mL
BNC740345-500 1x 500 µL

CD4 (EDU-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL
BNC740806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
BNC040218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF405S conjugate, 0.1mg/mL
BNC042110-100 1x 100 µL

PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/818), CF488A conjugate, 0.1mg/mL
BNC880818-500 1x 500 µL

CD45RA (PTPRC/818), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details