Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB)

This Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q318T6

Expression Region

1-241

Origin

Prochlorococcus marinus (strain MIT 9312)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLFNSLLTNFAALEVGQHLYWQIGNIRLHGQVFLTSWILLGALLVFISLGTKKMENDPKG LQNLLEFLWDYIRDLARTQIGEKVYRDWMPFIGTLFLFVFVSNWGGALIPWRLIKLPSGE LGAPTADINTTIALALLVSLSYFYAGLSNKGWRYFEYYVHPTPIMLPFKILEDFTKPLSL SFRLFGNILADELVVGVLVFLVPLILPIPVMFLGLFTSAIQALIFATLAAYYIGEAVEEH H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCN3B Protein Vector (Mouse) (pPM-C-HA)
PV227052 500 ng

SCN3B Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Abl1, phosphorylated (T735) discontinued
340816-01 100 µL

Abl1, phosphorylated (T735) discontinued

Sign In for Pricing
View Details
Abl1, phosphorylated (T735) discontinued
340816-02 200 µL

Abl1, phosphorylated (T735) discontinued

Sign In for Pricing
View Details
S100A4 Human shRNA Plasmid Kit (Locus ID 6275)
TG309668 1 Kit

S100A4 Human shRNA Plasmid Kit (Locus ID 6275)

Sign In for Pricing
View Details
MTCO1 polyclonal antibody
BS80168-01 50 µL

MTCO1 polyclonal antibody

Sign In for Pricing
View Details
MTCO1 polyclonal antibody
BS80168-02 100 µL

MTCO1 polyclonal antibody

Sign In for Pricing
View Details