Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB)

This Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q318T6

Expression Region

1-241

Origin

Prochlorococcus marinus (strain MIT 9312)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLFNSLLTNFAALEVGQHLYWQIGNIRLHGQVFLTSWILLGALLVFISLGTKKMENDPKG LQNLLEFLWDYIRDLARTQIGEKVYRDWMPFIGTLFLFVFVSNWGGALIPWRLIKLPSGE LGAPTADINTTIALALLVSLSYFYAGLSNKGWRYFEYYVHPTPIMLPFKILEDFTKPLSL SFRLFGNILADELVVGVLVFLVPLILPIPVMFLGLFTSAIQALIFATLAAYYIGEAVEEH H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrophage Marker (Macrophage L1 Protein) (Calprotectin) ; Clone MAC387 (Concentrate)
RA0287-C.5 0.5 mL

Macrophage Marker (Macrophage L1 Protein) (Calprotectin) ; Clone MAC387 (Concentrate)

Sign In for Pricing
View Details
N-Nitroso Desmethyl Telithromycin
CS-O-50064-10MG 1 Each

N-Nitroso Desmethyl Telithromycin

Sign In for Pricing
View Details
Canine Fibroblast Growth Factor 8 (FGF8) ELISA Kit
EIA07904Ca 1 Kit

Canine Fibroblast Growth Factor 8 (FGF8) ELISA Kit

Sign In for Pricing
View Details
SLC20A1P1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV785919 1.0 µg DNA

SLC20A1P1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
CF®514 Donkey Anti-Mouse IgG (H+L), Highly Cross-Adsorbed, 2 mg/mL
#20483-50uL 1x 50 µL

CF®514 Donkey Anti-Mouse IgG (H+L), Highly Cross-Adsorbed, 2 mg/mL

Sign In for Pricing
View Details
5-Oxo-5,6-dihydro-1,6-naphthyridine-2-carboxylic acid
EEC55525-01 50 mg

5-Oxo-5,6-dihydro-1,6-naphthyridine-2-carboxylic acid

Sign In for Pricing
View Details