Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB)

This Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q318T6

Expression Region

1-241

Origin

Prochlorococcus marinus (strain MIT 9312)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLFNSLLTNFAALEVGQHLYWQIGNIRLHGQVFLTSWILLGALLVFISLGTKKMENDPKG LQNLLEFLWDYIRDLARTQIGEKVYRDWMPFIGTLFLFVFVSNWGGALIPWRLIKLPSGE LGAPTADINTTIALALLVSLSYFYAGLSNKGWRYFEYYVHPTPIMLPFKILEDFTKPLSL SFRLFGNILADELVVGVLVFLVPLILPIPVMFLGLFTSAIQALIFATLAAYYIGEAVEEH H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dusp9 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3661204 1.0 µg DNA

Dusp9 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Recombinant Human CPE Protein, N-His
YHD19301 100 μg

Recombinant Human CPE Protein, N-His

Sign In for Pricing
View Details
BC003965 ORF Vector (Mouse) (pORF)
13056014 1.0 µg DNA

BC003965 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Borrelia p58
PT-A00541-01 5 µg

Borrelia p58

Sign In for Pricing
View Details
Borrelia p58
PT-A00541-02 20 µg

Borrelia p58

Sign In for Pricing
View Details
Borrelia p58
PT-A00541-03 1 mg

Borrelia p58

Sign In for Pricing
View Details