Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit a (atpB)

This Recombinant Synechococcus sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q3AZM6

Expression Region

1-241

Origin

Synechococcus sp. (strain CC9902)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALMPLSLPFAELEVGHHLYWQIGDLYLHGQVFLSSWILIGILLAFVLVGTRGMKRDPIG LQNLLEFLWDFIRDLARDQIGEKYYRDWLPFIGTLFLFIFVSNWGGALIPWKIIELPEGE LGAPTADINTTVAMALLVSLAYFYAGLSRKGLRFFELYVEPTPIMLPFKIIEEFTKPLSL SFRLFGNILADELAVGVLVYLVPLIVPLPVMLLGLFTSAIQALIFATLAAFYIGEGLHEA H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ipaf Antibody
3107-002mg 0.02 mg

Ipaf Antibody

Sign In for Pricing
View Details
SLC47A1 Adenovirus (Human)
44213052 1.0 mL

SLC47A1 Adenovirus (Human)

Sign In for Pricing
View Details
ACR Protein (N-His, Human)
P500196 100 µg

ACR Protein (N-His, Human)

Sign In for Pricing
View Details
Hist1H3A (Ab-36) Polyclonal Antibody
CAC11292-01 50 µL

Hist1H3A (Ab-36) Polyclonal Antibody

Sign In for Pricing
View Details
Hist1H3A (Ab-36) Polyclonal Antibody
CAC11292-02 100 µL

Hist1H3A (Ab-36) Polyclonal Antibody

Sign In for Pricing
View Details
NIPAL2 Polyclonal Antibody, PE-Cy7 Conjugated
bs-11096R-PE-Cy7 100 µL

NIPAL2 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details