Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit a (atpB)

This Recombinant Synechococcus sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q3AZM6

Expression Region

1-241

Origin

Synechococcus sp. (strain CC9902)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALMPLSLPFAELEVGHHLYWQIGDLYLHGQVFLSSWILIGILLAFVLVGTRGMKRDPIG LQNLLEFLWDFIRDLARDQIGEKYYRDWLPFIGTLFLFIFVSNWGGALIPWKIIELPEGE LGAPTADINTTVAMALLVSLAYFYAGLSRKGLRFFELYVEPTPIMLPFKIIEEFTKPLSL SFRLFGNILADELAVGVLVYLVPLIVPLPVMLLGLFTSAIQALIFATLAAFYIGEGLHEA H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Hedgehog Homolog, Sonic ELISA kit
GTR10451810 96 Well

Mouse Hedgehog Homolog, Sonic ELISA kit

Sign In for Pricing
View Details
Monoclonal Anti-African Swine Fever (ASF) Virus P30 protein Ab
MBS122237-01 0.1 mg

Monoclonal Anti-African Swine Fever (ASF) Virus P30 protein Ab

Sign In for Pricing
View Details
Monoclonal Anti-African Swine Fever (ASF) Virus P30 protein Ab
MBS122237-02 1 mg

Monoclonal Anti-African Swine Fever (ASF) Virus P30 protein Ab

Sign In for Pricing
View Details
Monoclonal Anti-African Swine Fever (ASF) Virus P30 protein Ab
MBS122237-03 5x 1 mg

Monoclonal Anti-African Swine Fever (ASF) Virus P30 protein Ab

Sign In for Pricing
View Details
DCIP-1, CXCL3, human
RC332-14 2ug

DCIP-1, CXCL3, human

Sign In for Pricing
View Details
Mouse Gm8579 activation kit by CRISPRa
GA218376 1 Kit

Mouse Gm8579 activation kit by CRISPRa

Sign In for Pricing
View Details