Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit a (atpB)

This Recombinant Synechococcus sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q3AHK0

Expression Region

1-241

Origin

Synechococcus sp. (strain CC9605)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLPLPLPFAELEVGHHLYWQIGDLYLHGQVFLSSWILIGILLAVVLVGTRGMKRDPIG LQNLLEFLWNFIRDIARDNIGEKYYRDWLPFIGTLFLFIFVSNWGGALIPWKIFELPEGE LGAPTADINTTVAMALLVSLAYFYAGLSRKGLRFFELYVEPTPIMLPFKIIEEFTKPLSL SFRLFGNILADELAVGVLVYLVPLIVPLPVMLLGLFTSAIQALIFATLASFYIGEGLHEA H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plunc (BPIFA1) Goat Polyclonal Antibody
AP32817PU-N 100 µg

Plunc (BPIFA1) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Sodium Isovalerate
TRC-S539660-2.5G 2.5 g

Sodium Isovalerate

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS508202 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS643564 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
USP40 Human Gene Knockout Kit (CRISPR)
KN419120 1 Kit

USP40 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
tert-Butyl Oxobutyrate
TRC-B693435-250ML 250 mL

tert-Butyl Oxobutyrate

Sign In for Pricing
View Details