Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit a (atpB)

This Recombinant Synechococcus sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q3AHK0

Expression Region

1-241

Origin

Synechococcus sp. (strain CC9605)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLPLPLPFAELEVGHHLYWQIGDLYLHGQVFLSSWILIGILLAVVLVGTRGMKRDPIG LQNLLEFLWNFIRDIARDNIGEKYYRDWLPFIGTLFLFIFVSNWGGALIPWKIFELPEGE LGAPTADINTTVAMALLVSLAYFYAGLSRKGLRFFELYVEPTPIMLPFKIIEEFTKPLSL SFRLFGNILADELAVGVLVYLVPLIVPLPVMLLGLFTSAIQALIFATLASFYIGEGLHEA H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Tumor Necrosis Factor Beta (TNFb) ELISA Kit
RDR-TNFb-p-01 96 Tests

Porcine Tumor Necrosis Factor Beta (TNFb) ELISA Kit

Sign In for Pricing
View Details
Porcine Tumor Necrosis Factor Beta (TNFb) ELISA Kit
RDR-TNFb-p-02 48 Tests

Porcine Tumor Necrosis Factor Beta (TNFb) ELISA Kit

Sign In for Pricing
View Details
Recombinant SV40 T Antigen Antibody
RC-5934-01 50 μL

Recombinant SV40 T Antigen Antibody

Sign In for Pricing
View Details
Recombinant SV40 T Antigen Antibody
RC-5934-02 100 µL

Recombinant SV40 T Antigen Antibody

Sign In for Pricing
View Details
Recombinant SV40 T Antigen Antibody
RC-5934-03 1 mL

Recombinant SV40 T Antigen Antibody

Sign In for Pricing
View Details
ZKSCAN5 (NM_145102) Human Over-expression Lysate
LY403424 100 µg

ZKSCAN5 (NM_145102) Human Over-expression Lysate

Sign In for Pricing
View Details