Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit a (atpB)

This Recombinant Synechococcus sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q3AHK0

Expression Region

1-241

Origin

Synechococcus sp. (strain CC9605)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLPLPLPFAELEVGHHLYWQIGDLYLHGQVFLSSWILIGILLAVVLVGTRGMKRDPIG LQNLLEFLWNFIRDIARDNIGEKYYRDWLPFIGTLFLFIFVSNWGGALIPWKIFELPEGE LGAPTADINTTVAMALLVSLAYFYAGLSRKGLRFFELYVEPTPIMLPFKIIEEFTKPLSL SFRLFGNILADELAVGVLVYLVPLIVPLPVMLLGLFTSAIQALIFATLASFYIGEGLHEA H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF555 conjugate, 0.1mg/mL
BNC550333-100 1x 100 µL

CD8 (RIV11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM49C (NM_001195234) Human Over-expression Lysate
LC433834 20 µg

TRIM49C (NM_001195234) Human Over-expression Lysate

Sign In for Pricing
View Details
RET Mouse Monoclonal Antibody [Clone ID: OTI5C5]
CF805767 100 µg

RET Mouse Monoclonal Antibody [Clone ID: OTI5C5]

Sign In for Pricing
View Details
PDCD6 Human Gene Knockout Kit (CRISPR)
KN402030 1 Kit

PDCD6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2673), CF640R conjugate, 0.1mg/mL
BNC402673-100 1x 100 µL

CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2673), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Microwave Digester BMWD-103
BMWD-103 1 Unit

Microwave Digester BMWD-103

Sign In for Pricing
View Details