Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB)

This Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q46J52

Expression Region

1-241

Origin

Prochlorococcus marinus (strain NATL2A)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGFLPFVFPFAELEVGQQLYWQIGNFRIHGQVFMTSWLLIGALLALVVIGTKKMERDPRG VQNLLEFLWDYIRDLARTQIGEKVYRDWMPFIGTLFLFIFVSNWGGALVPWKLIKLPSGE LGAPTADINTTVALALLVSLSYFYAGLSNKGLRYFEYYVHPTPIMLPFKIVEDFTKPLSL SFRLFGNILADELVVAVLVFLVPLVLPVPVMFLGLFTSAIQALIFATLAAYYIGEAVEEH H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF8 (Krueppel-like Factor 8, Basic Krueppel-like Factor 3, Zinc Finger Protein 741, BKLF3, ZNF741) APC
MBS6383675-01 0.1 mL

KLF8 (Krueppel-like Factor 8, Basic Krueppel-like Factor 3, Zinc Finger Protein 741, BKLF3, ZNF741) APC

Sign In for Pricing
View Details
KLF8 (Krueppel-like Factor 8, Basic Krueppel-like Factor 3, Zinc Finger Protein 741, BKLF3, ZNF741) APC
MBS6383675-02 5x 0.1 mL

KLF8 (Krueppel-like Factor 8, Basic Krueppel-like Factor 3, Zinc Finger Protein 741, BKLF3, ZNF741) APC

Sign In for Pricing
View Details
STX10 Rabbit pAb
A13827 1000 μL

STX10 Rabbit pAb

Sign In for Pricing
View Details
SLC66A1 Human Over-expression Lysate
orb1363895 20 µg

SLC66A1 Human Over-expression Lysate

Sign In for Pricing
View Details
Dog IgG (H&L) Antibody - Rhodamine Conjugated
OARA05079-2MG 2 mg

Dog IgG (H&L) Antibody - Rhodamine Conjugated

Sign In for Pricing
View Details
CD276 Recombinant Rabbit mAb
E43S47987 100 µL

CD276 Recombinant Rabbit mAb

Sign In for Pricing
View Details