Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0998 (MJ0998)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0998 (MJ0998) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0998

UniProt

Q58404

Expression Region

1-241

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSLYALIFLLFVIVVSYIFNGLWSVFNIKHVFWVNLFLLIAFHPQHLDGLIILLLIPLK IFSNFKLKLQCIIALVGILLTIIKGVIKSGFGWILRILFFFVRMMTVSFINLVVFSILLT SVYVLGYVAFLKPDDIQFGTLYTAFGGLALLGAGIKIIQHFIKQSEEIAQEEFKKWYETE VKNFMYSLFITAKNAFPKFLDDLLAKGVVSQEEYQNLIKLYSHILARILKNDEEKMKIPT F

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human WDR88 activation kit by CRISPRa
GA114926 1 Kit

Human WDR88 activation kit by CRISPRa

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (MBS-12), CF568 conjugate, 0.1mg/mL
BNC680521-100 1x 100 µL

AFP (Alpha Fetoprotein) (MBS-12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SECISBP2 (Center) Rabbit Polyclonal Antibody
AP53835PU-N 400 µL

SECISBP2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human TNF Receptor Associated Factor 6 (TRAF6) ELISA Kit
RD-TRAF6-Hu-01 96 Tests

Human TNF Receptor Associated Factor 6 (TRAF6) ELISA Kit

Sign In for Pricing
View Details
Human TNF Receptor Associated Factor 6 (TRAF6) ELISA Kit
RD-TRAF6-Hu-02 48 Tests

Human TNF Receptor Associated Factor 6 (TRAF6) ELISA Kit

Sign In for Pricing
View Details
Uncoated Monkey sCD14 (Soluble Cluster of Differentiation 14) ELISA Kit
E-UNEL-MK0008-01 5x 96 Tests

Uncoated Monkey sCD14 (Soluble Cluster of Differentiation 14) ELISA Kit

Sign In for Pricing
View Details