Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0998 (MJ0998)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0998 (MJ0998) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0998

UniProt

Q58404

Expression Region

1-241

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSLYALIFLLFVIVVSYIFNGLWSVFNIKHVFWVNLFLLIAFHPQHLDGLIILLLIPLK IFSNFKLKLQCIIALVGILLTIIKGVIKSGFGWILRILFFFVRMMTVSFINLVVFSILLT SVYVLGYVAFLKPDDIQFGTLYTAFGGLALLGAGIKIIQHFIKQSEEIAQEEFKKWYETE VKNFMYSLFITAKNAFPKFLDDLLAKGVVSQEEYQNLIKLYSHILARILKNDEEKMKIPT F

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Seh1l Mouse Gene Knockout Kit (CRISPR)
KN515479 1 Kit

Seh1l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CYP7B1 (C-term) Goat Polyclonal Antibody
AP20144PU-N 100 µg

CYP7B1 (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Gemin 5 (GEMIN5) (NM_015465) Human Recombinant Protein
TP317516L 1 mg

Gemin 5 (GEMIN5) (NM_015465) Human Recombinant Protein

Sign In for Pricing
View Details
PROCR Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E7]
TA805524AM 100 µL

PROCR Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E7]

Sign In for Pricing
View Details
Vimentin (VIM) Mouse Monoclonal Antibody [Clone ID: 2D1]
AM32993PU-N 100 µL

Vimentin (VIM) Mouse Monoclonal Antibody [Clone ID: 2D1]

Sign In for Pricing
View Details
Aniline-15N
TRC-A662476-250MG 250 mg

Aniline-15N

Sign In for Pricing
View Details