Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0998 (MJ0998)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0998 (MJ0998) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0998

UniProt

Q58404

Expression Region

1-241

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSLYALIFLLFVIVVSYIFNGLWSVFNIKHVFWVNLFLLIAFHPQHLDGLIILLLIPLK IFSNFKLKLQCIIALVGILLTIIKGVIKSGFGWILRILFFFVRMMTVSFINLVVFSILLT SVYVLGYVAFLKPDDIQFGTLYTAFGGLALLGAGIKIIQHFIKQSEEIAQEEFKKWYETE VKNFMYSLFITAKNAFPKFLDDLLAKGVVSQEEYQNLIKLYSHILARILKNDEEKMKIPT F

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmoglein-3 (Squamous Cell Marker) (DSG3/2796), 0.2mg/mL
BNUB2796-500 1x 500 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2796), 0.2mg/mL

Sign In for Pricing
View Details
NSMCE1 Human Gene Knockout Kit (CRISPR)
KN418073 1 Kit

NSMCE1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/799), CF640R conjugate, 0.1mg/mL
BNC400799-500 1x 500 µL

Cytokeratin 19 (KRT19/799), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARID1A Recombinant Rabbit Monoclonal Antibody [JJ09-01]
ET1701-60 100 µL

ARID1A Recombinant Rabbit Monoclonal Antibody [JJ09-01]

Sign In for Pricing
View Details
Tissue Total RNA, Colon: sigmoid
CR560888 5 µg

Tissue Total RNA, Colon: sigmoid

Sign In for Pricing
View Details
TAPA1 (CD81) Rabbit Monoclonal Antibody [Clone ID: R02-3D6]
TA421855 100 µL

TAPA1 (CD81) Rabbit Monoclonal Antibody [Clone ID: R02-3D6]

Sign In for Pricing
View Details