Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit a (atpB)

This Recombinant Synechococcus sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q7U8X0

Expression Region

1-241

Origin

Synechococcus sp. (strain WH8102)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLPFPLPFAELEVGHHLYWQIGDLYLHGQVFLSSWILIGILLVLVLAGTRNMQRDPLG LQNLLEFLWNFIRDIARDNIGEKYYRDWLPFIGTLFLFIFISNWGGALIPWKIIELPEGE LGAPTADINTTVAMALLVSLAYFYAGLSRKGLRFFELYVEPTPIMLPFKIIEEFTKPLSL SFRLFGNILADELAVGVLVYLVPLLVPLPVMLLGLFTSAIQALIFATLTAFYIGEGLHEA H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRA2 (FOSL2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B4]
TA809660AM 100 µL

FRA2 (FOSL2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B4]

Sign In for Pricing
View Details
Calprotectin / MRP14 / S100A9 / Calgranulin B (rMAC3781), CF594 conjugate, 0.1mg/mL
BNC943781-100 1x 100 µL

Calprotectin / MRP14 / S100A9 / Calgranulin B (rMAC3781), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CGB1 activation kit by CRISPRa
GA114434 1 Kit

Human CGB1 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/1190), Biotin conjugate, 0.1mg/mL
BNCB1190-500 1x 500 µL

Cytokeratin 18 (KRT18/1190), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IRGQ (NM_001007561) Human Over-expression Lysate
LY423512 100 µg

IRGQ (NM_001007561) Human Over-expression Lysate

Sign In for Pricing
View Details
ADD1 Antibody
KC-17954-01 50 μL

ADD1 Antibody

Sign In for Pricing
View Details