Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit a (atpB)

This Recombinant Synechococcus sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q7U8X0

Expression Region

1-241

Origin

Synechococcus sp. (strain WH8102)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLPFPLPFAELEVGHHLYWQIGDLYLHGQVFLSSWILIGILLVLVLAGTRNMQRDPLG LQNLLEFLWNFIRDIARDNIGEKYYRDWLPFIGTLFLFIFISNWGGALIPWKIIELPEGE LGAPTADINTTVAMALLVSLAYFYAGLSRKGLRFFELYVEPTPIMLPFKIIEEFTKPLSL SFRLFGNILADELAVGVLVYLVPLLVPLPVMLLGLFTSAIQALIFATLTAFYIGEGLHEA H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTLRP (GHRL) (NM_016362) Human Recombinant Protein
TP306989L 1 mg

MTLRP (GHRL) (NM_016362) Human Recombinant Protein

Sign In for Pricing
View Details
2-(1-Hydroxyethyl) Promazine-d4
TRC-H942297-25MG 25 mg

2-(1-Hydroxyethyl) Promazine-d4

Sign In for Pricing
View Details
Usp7 Mouse Gene Knockout Kit (CRISPR)
KN318814LP 1 Kit

Usp7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Syntrophin gamma 2 (SNTG2) activation kit by CRISPRa
GA110078 1 Kit

Human Syntrophin gamma 2 (SNTG2) activation kit by CRISPRa

Sign In for Pricing
View Details
GATA2 (NM_032638) Human Over-expression Lysate
LY403182 100 µg

GATA2 (NM_032638) Human Over-expression Lysate

Sign In for Pricing
View Details
Triethyleneglycol Monolauryl Ether
TRC-T776530-1G 1 g

Triethyleneglycol Monolauryl Ether

Sign In for Pricing
View Details