Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB)

This Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q7VA58

Expression Region

1-241

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTSPFVLPFAALEVGQHLYWQIGKLRIHGQVFMTSWILIGALLTLVVVGTKKMERDPKG VQNLLEFLWDYIRDLARTQIGEKVYRDWMPFIGTLFLFIFVSNWGGALIPWKLIELPSGE LGAPTADINTTVALALLVSLSYFYAGLSNKGLRYFEYYVHPTPIMLPFKIVEDFTKPLSL SFRLFGNILADELVVAVLVFLVPLVLPVPVMFLGLFTSAIQALIFATLAAYYIGEAVEEH H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thy1 (Thy1 Cell Surface Antigen, CD90, FLJ33325) (MaxLight 650)
MBS6440639-01 0.1 mL

Thy1 (Thy1 Cell Surface Antigen, CD90, FLJ33325) (MaxLight 650)

Sign In for Pricing
View Details
Thy1 (Thy1 Cell Surface Antigen, CD90, FLJ33325) (MaxLight 650)
MBS6440639-02 5x 0.1 mL

Thy1 (Thy1 Cell Surface Antigen, CD90, FLJ33325) (MaxLight 650)

Sign In for Pricing
View Details
Anti-HSD-4/RNF138 Antibody Picoband®, Cy3 Conjugate
A09061-Cy3 100 µg/Vial

Anti-HSD-4/RNF138 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
HDAC2, ID (HDAC2, Histone deacetylase 2) (PE) discontinued
036477-PE 200 µL

HDAC2, ID (HDAC2, Histone deacetylase 2) (PE) discontinued

Sign In for Pricing
View Details
Horse Leucine-Rich Repeat-Containing Protein 8A (LRRC8A) ELISA Kit
MBS9941185-01 48 Well

Horse Leucine-Rich Repeat-Containing Protein 8A (LRRC8A) ELISA Kit

Sign In for Pricing
View Details
Horse Leucine-Rich Repeat-Containing Protein 8A (LRRC8A) ELISA Kit
MBS9941185-02 96 Well

Horse Leucine-Rich Repeat-Containing Protein 8A (LRRC8A) ELISA Kit

Sign In for Pricing
View Details