Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris ATP synthase subunit a (atpB)

This Recombinant Prochlorococcus marinus subsp. pastoris ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q7V032

Expression Region

1-241

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFLNSLPTNFAALEVGQHLYWQIGNIRLHGQVFLTSWILLGALLVFISVGTKKMENDPKG LQNLLEFLWDYIRDLSRTQIGEKVYRDWMPFIGTLFLFVFVSNWGGALIPWRLIKLPSGE LGAPTADINTTIALALLVSLSYFYAGLSNKGWRYFEYYVHPTPIMLPFKILEDFTKPLSL SFRLFGNILADELVVGVLVFLVPLVLPIPVMFLGLFTSAIQALIFATLAAYYIGEAVEEH H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP2CA Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV694045 1.0 µg DNA

PPP2CA Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
GRAMD1A siRNA (Mouse)
MBS8227228-01 15 nmol

GRAMD1A siRNA (Mouse)

Sign In for Pricing
View Details
GRAMD1A siRNA (Mouse)
MBS8227228-02 30 nmol

GRAMD1A siRNA (Mouse)

Sign In for Pricing
View Details
GRAMD1A siRNA (Mouse)
MBS8227228-03 5x 30 nmol

GRAMD1A siRNA (Mouse)

Sign In for Pricing
View Details
L-Aspartic acid di-tert-butyl ester hydrochloride
sc-255238A 5 g

L-Aspartic acid di-tert-butyl ester hydrochloride

Sign In for Pricing
View Details
Phospho-Gli1 (T101/ S102/S104) Rabbit Polyclonal Antibody (BF680)
orb2443370 100 µL

Phospho-Gli1 (T101/ S102/S104) Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details