Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris ATP synthase subunit a (atpB)

This Recombinant Prochlorococcus marinus subsp. pastoris ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q7V032

Expression Region

1-241

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFLNSLPTNFAALEVGQHLYWQIGNIRLHGQVFLTSWILLGALLVFISVGTKKMENDPKG LQNLLEFLWDYIRDLSRTQIGEKVYRDWMPFIGTLFLFVFVSNWGGALIPWRLIKLPSGE LGAPTADINTTIALALLVSLSYFYAGLSNKGWRYFEYYVHPTPIMLPFKILEDFTKPLSL SFRLFGNILADELVVGVLVFLVPLVLPIPVMFLGLFTSAIQALIFATLAAYYIGEAVEEH H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTGS2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
38103064 1.0 µg DNA

PTGS2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PAX4 antibody - N-terminal region
MBS3201131-01 0.1 mL

PAX4 antibody - N-terminal region

Sign In for Pricing
View Details
PAX4 antibody - N-terminal region
MBS3201131-02 5x 0.1 mL

PAX4 antibody - N-terminal region

Sign In for Pricing
View Details
Rabbit Monoclonal Bcl-6 Antibody (BCL6/2497R) [Biotin]
NBP3-08313B 100 µL

Rabbit Monoclonal Bcl-6 Antibody (BCL6/2497R) [Biotin]

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. holarctica Bifunctional protein FolD (folD)
MBS1132963-01 0.02 mg (E-Coli)

Recombinant Francisella tularensis subsp. holarctica Bifunctional protein FolD (folD)

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. holarctica Bifunctional protein FolD (folD)
MBS1132963-02 0.02 mg (Yeast)

Recombinant Francisella tularensis subsp. holarctica Bifunctional protein FolD (folD)

Sign In for Pricing
View Details