Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Picrophilus torridus Cobalamin synthase (cobS)

This Recombinant Picrophilus torridus Cobalamin synthase (cobS) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q6L174

Expression Region

1-241

Origin

Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQGLKSAISFFTIIPVKADLNKNIVFFFTITGAITGLMAASIFYLTSFINQLLASVASVS FLIIIYGFNHADAVLDLGDTFMVHDPEKKKIIIKDVYHGTGSVVTFFIIYIITISLLSSF NSIQGSIALILSETISRFSMLMSMYKSNSFSGGISEIFISYFDKPFKITFFNFLVIILIF LIFYKYIIFTMFSLISIVISYYFKSHEQKIFNGINGDIIGFTGELSRLISLLLILISFKL I

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Ribonuclease A5 (RNASE5) ELISA Kit
RDR-RNASE5-Ra-01 96 Tests

Rat Ribonuclease A5 (RNASE5) ELISA Kit

Sign In for Pricing
View Details
Rat Ribonuclease A5 (RNASE5) ELISA Kit
RDR-RNASE5-Ra-02 48 Tests

Rat Ribonuclease A5 (RNASE5) ELISA Kit

Sign In for Pricing
View Details
katanin p80 (KATNB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B6]
TA503806BM 100 µL

katanin p80 (KATNB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B6]

Sign In for Pricing
View Details
CCS Antibody
8C15251-AAT 50 µg

CCS Antibody

Sign In for Pricing
View Details
6-Phenyltridecane
TRC-P184025-50MG 50 mg

6-Phenyltridecane

Sign In for Pricing
View Details
Calr3 Mouse Gene Knockout Kit (CRISPR)
KN502470 1 Kit

Calr3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details