Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanopyrus kandleri Cobalamin synthase (cobS)

This Recombinant Methanopyrus kandleri Cobalamin synthase (cobS) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8TUT2

Expression Region

1-241

Origin

Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIRVEFLKVFRFLTVLPIGEHPKSPREIGEQAWLGLPAVGLVSGLLAGVVAWAFAGTPVR GCLVVLTLLVLEGAQHFDGLVDVGDALMAGVISEEGATKAMRDPRVGVGGLAIGSMALLL AVASFGWIPFEVLVPIEVFSRFTVLPMAAVGEPAPASYSGRVFTEYVDADQVLLGGILST VVSLPFSPVATLTCAVCSAVVAWTCLEAARRTIRGVNGDFLGASIWVSRVLSAVCLSSLP W

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal DLL1 Antibody (306) [Alexa Fluor 405]
NBP2-89936AF405 0.1 mL

Rabbit Monoclonal DLL1 Antibody (306) [Alexa Fluor 405]

Sign In for Pricing
View Details
2- (Acetyloxy) benzoic Acid 4-Methylphenyl Ester
001148 50 mg

2- (Acetyloxy) benzoic Acid 4-Methylphenyl Ester

Sign In for Pricing
View Details
ITPRIP antibody
MBS5303383-01 0.1 mL

ITPRIP antibody

Sign In for Pricing
View Details
ITPRIP antibody
MBS5303383-02 5x 0.1 mL

ITPRIP antibody

Sign In for Pricing
View Details
PF-8380
A3720-5.1 10 mM (in 1mL DMSO)

PF-8380

Sign In for Pricing
View Details
Rat Zfp839 Pre-designed siRNA Set A
SI216448A 1 Each

Rat Zfp839 Pre-designed siRNA Set A

Sign In for Pricing
View Details