Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanopyrus kandleri Cobalamin synthase (cobS)

This Recombinant Methanopyrus kandleri Cobalamin synthase (cobS) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8TUT2

Expression Region

1-241

Origin

Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIRVEFLKVFRFLTVLPIGEHPKSPREIGEQAWLGLPAVGLVSGLLAGVVAWAFAGTPVR GCLVVLTLLVLEGAQHFDGLVDVGDALMAGVISEEGATKAMRDPRVGVGGLAIGSMALLL AVASFGWIPFEVLVPIEVFSRFTVLPMAAVGEPAPASYSGRVFTEYVDADQVLLGGILST VVSLPFSPVATLTCAVCSAVVAWTCLEAARRTIRGVNGDFLGASIWVSRVLSAVCLSSLP W

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMN-STOOM3BAR-G3-RLL090 Pipe Markers for Steam
269744 505 Roll (505 Marker (s) x 1 Roll)

PMN-STOOM3BAR-G3-RLL090 Pipe Markers for Steam

Sign In for Pricing
View Details
Mouse Protein Tyrosine Phosphatase Like Protein A (PTPLA) ELISA Kit
EKN52490-01 48 Tests

Mouse Protein Tyrosine Phosphatase Like Protein A (PTPLA) ELISA Kit

Sign In for Pricing
View Details
Mouse Protein Tyrosine Phosphatase Like Protein A (PTPLA) ELISA Kit
EKN52490-02 96 Tests

Mouse Protein Tyrosine Phosphatase Like Protein A (PTPLA) ELISA Kit

Sign In for Pricing
View Details
Mouse Protein Tyrosine Phosphatase Like Protein A (PTPLA) ELISA Kit
EKN52490-03 5x 96 Tests

Mouse Protein Tyrosine Phosphatase Like Protein A (PTPLA) ELISA Kit

Sign In for Pricing
View Details
FRY CRISPR Activation Plasmid (m)
sc-435754-ACT 20 µg

FRY CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Mouse calpastatin/calpain inhibitor ELISA kit
GTR10392340 96 Well

Mouse calpastatin/calpain inhibitor ELISA kit

Sign In for Pricing
View Details