Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB)

This Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A2BT30

Expression Region

1-241

Origin

Prochlorococcus marinus (strain AS9601)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFFNSLLTNFAALEVGQHLYWQIGNIRLHGQVFLTSWILLGALLVFISFGTKKMENDPKG LQNLLEFLWDYIRDLARTQIGEKVYRDWMPFIGTLFLFVFVSNWGGALIPWRLIKLPSGE LGAPTADINTTIALALLVSLSYFYAGLSNKGWRYFEYYVHPTPIMLPFKILEDFTKPLSL SFRLFGNILADELVVGVLVFLVPLILPIPVMFLGLFTSAIQALIFATLAAYYIGEAVEEH H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ceacam1 ORF Vector (Mouse) (pORF)
15800015 1.0 µg DNA

Ceacam1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
FAS ELISA Kit (Human) : 96 Wells (OKEH00048)
OKEH00048 96 Well

FAS ELISA Kit (Human) : 96 Wells (OKEH00048)

Sign In for Pricing
View Details
Cyclo (Ile-Val)
orb1680302 10 mg

Cyclo (Ile-Val)

Sign In for Pricing
View Details
Lactadherin Polyclonal Antibody
MBS9415901-01 0.1 mg

Lactadherin Polyclonal Antibody

Sign In for Pricing
View Details
Lactadherin Polyclonal Antibody
MBS9415901-02 5x 0.1 mg

Lactadherin Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Inhibin beta B chain, INHBB ELISA Kit
MBS1609825 96 Well

Mouse Inhibin beta B chain, INHBB ELISA Kit

Sign In for Pricing
View Details