Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB)

This Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A2C4K0

Expression Region

1-241

Origin

Prochlorococcus marinus (strain NATL1A)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGFLPFVFPFAELEVGQQLYWQIGNFRIHGQVFMTSWLLIGALLALVVIGTKKMERDPRG VQNLLEFLWDYIRDLARTQIGEKVYRDWMPFIGTLFLFIFVSNWGGALVPWKLIKLPSGE LGAPTADINTTVALALLVSLSYFYAGLSNKGLRYFEYYVHPTPIMLPFKIVEDFTKPLSL SFRLFGNILADELVVAVLVFLVPLVLPVPVMFLGLFTSAIQALIFATLAAYYIGEAVEEH H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fluor700 Anti-Mouse Ly6G Antibody [1A8]
MBS2579486-01 0.025 mg

Fluor700 Anti-Mouse Ly6G Antibody [1A8]

Sign In for Pricing
View Details
Fluor700 Anti-Mouse Ly6G Antibody [1A8]
MBS2579486-02 0.1 mg

Fluor700 Anti-Mouse Ly6G Antibody [1A8]

Sign In for Pricing
View Details
Fluor700 Anti-Mouse Ly6G Antibody [1A8]
MBS2579486-03 5x 0.1 mg

Fluor700 Anti-Mouse Ly6G Antibody [1A8]

Sign In for Pricing
View Details
BPTC-63-439-GR Continuous Tapes for Printers
217521 1 Pack (1 Roll x 1 Roll)

BPTC-63-439-GR Continuous Tapes for Printers

Sign In for Pricing
View Details
POTEH sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1689908 1.0 µg DNA

POTEH sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human Putative zinc finger protein 852 (ZNF852) ELISA Kit
abx555055 96 Tests

Human Putative zinc finger protein 852 (ZNF852) ELISA Kit

Sign In for Pricing
View Details