Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB)

This Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A2C6X0

Expression Region

1-241

Origin

Prochlorococcus marinus (strain MIT 9303)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGFLPIALPFAELEVGQHLYWQIGNLQLHGQVFLTSWIVIGAILALVVVGTRKMERDPHG VQNLLEFLWDYIRDLARTQIGEKAYRDWMPFIGTLFLFIFVSNWGGSLVPWKLIHLPSGE LGAPTADINTTVALALLVSLSYFYAGLSRKGLRYFEYYVHPTPIMIPFKIVEDFTKPLSL SFRLFGNILADELVVAVLVFLVPLFLPVPVMFLGLFTSAIQALIFATLAAYYIGEAVEEH H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Strbp AAV siRNA Pooled Vector
45775166 1.0 µg

Strbp AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ITGAE sgRNA CRISPR Lentivector (Human) (Target 1)
K1104302 1.0 µg DNA

ITGAE sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
GSTM5 (NM_000851) Human Recombinant Protein
TP308900M 100 µg

GSTM5 (NM_000851) Human Recombinant Protein

Sign In for Pricing
View Details
MT4 CytoSection
TS414104P5 25 Slides

MT4 CytoSection

Sign In for Pricing
View Details
HS1BP3 Protein Vector (Human) (pPB-C-His)
PV020309 500 ng

HS1BP3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Sulf-2 Antibody
E51A08219 100 µL

Sulf-2 Antibody

Sign In for Pricing
View Details