Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB)

This Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A2C6X0

Expression Region

1-241

Origin

Prochlorococcus marinus (strain MIT 9303)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGFLPIALPFAELEVGQHLYWQIGNLQLHGQVFLTSWIVIGAILALVVVGTRKMERDPHG VQNLLEFLWDYIRDLARTQIGEKAYRDWMPFIGTLFLFIFVSNWGGSLVPWKLIHLPSGE LGAPTADINTTVALALLVSLSYFYAGLSRKGLRYFEYYVHPTPIMIPFKIVEDFTKPLSL SFRLFGNILADELVVAVLVFLVPLFLPVPVMFLGLFTSAIQALIFATLAAYYIGEAVEEH H

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Burkholderia pseudomallei NADH-quinone oxidoreductase subunit A (nuoA)
orb2933364-01 20 µg

Recombinant Burkholderia pseudomallei NADH-quinone oxidoreductase subunit A (nuoA)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei NADH-quinone oxidoreductase subunit A (nuoA)
orb2933364-02 100 µg

Recombinant Burkholderia pseudomallei NADH-quinone oxidoreductase subunit A (nuoA)

Sign In for Pricing
View Details
Malt1 Antibody
42-376 0.1 mg

Malt1 Antibody

Sign In for Pricing
View Details
HHCM Polyclonal Antibody, RBITC Conjugated
bs-15475R-RBITC 100 µL

HHCM Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
LYVE1 Rabbit Polyclonal Antibody
E28PN2185 100 µL

LYVE1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Duck Testis-Expressed Sequence 9 Protein (TEX9) ELISA Kit
MBS9361755 Inquire

Duck Testis-Expressed Sequence 9 Protein (TEX9) ELISA Kit

Sign In for Pricing
View Details