Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB)

This Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A2C6X0

Expression Region

1-241

Origin

Prochlorococcus marinus (strain MIT 9303)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGFLPIALPFAELEVGQHLYWQIGNLQLHGQVFLTSWIVIGAILALVVVGTRKMERDPHG VQNLLEFLWDYIRDLARTQIGEKAYRDWMPFIGTLFLFIFVSNWGGSLVPWKLIHLPSGE LGAPTADINTTVALALLVSLSYFYAGLSRKGLRYFEYYVHPTPIMIPFKIVEDFTKPLSL SFRLFGNILADELVVAVLVFLVPLFLPVPVMFLGLFTSAIQALIFATLAAYYIGEAVEEH H

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calpain-1 catalytic subunit (CAPN1) (HRP)
308890-01 50 µg

Calpain-1 catalytic subunit (CAPN1) (HRP)

Sign In for Pricing
View Details
Calpain-1 catalytic subunit (CAPN1) (HRP)
308890-02 100 µg

Calpain-1 catalytic subunit (CAPN1) (HRP)

Sign In for Pricing
View Details
Recombinant Caenorhabditis Elegans K02D10.2 Protein (aa 1-124)
VAng-Ly3484-1mgEcoli 1 mg (E. coli)

Recombinant Caenorhabditis Elegans K02D10.2 Protein (aa 1-124)

Sign In for Pricing
View Details
Leonurine
S3890-25mg 25 mg

Leonurine

Sign In for Pricing
View Details
Human TUBD1 (NM_001193613) AAV Particle
RC231084A1V 250 µL

Human TUBD1 (NM_001193613) AAV Particle

Sign In for Pricing
View Details
RXFP1 Rabbit Polyclonal Antibody
orb2954627-01 50 µg

RXFP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details