Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB)

This Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A9BCE4

Expression Region

1-241

Origin

Prochlorococcus marinus (strain MIT 9211)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSFPFLLPFAELEVGQHLYWQLGNIRIHGQVFMTSWLLIGALLTLVVVGTKKMERDPKG VQNLLEFLWDYIRDLARTQIGEKVYRDWMPFIGTLFLFIFVSNWGGALVPWRLIRLPSGE LGAPTADINTTVALALLVSLSYFYAGLSNKGLRYFEYYVHPTPIMLPFKIVEDFTKPLSL SFRLFGNILADELVVAVLVFLVPLVLPVPVMFLGLFTSAIQALIFATLAAYYIGEAVEEH H

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGPAT1 Knockout A549 Polyclonal Cells
ARG31405 1 Million

AGPAT1 Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details
SCGN Rabbit Polyclonal Antibody
E10G02884 100 µL

SCGN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SMG5 Antibody
C48627-01 50 μL

SMG5 Antibody

Sign In for Pricing
View Details
SMG5 Antibody
C48627-02 100 µL

SMG5 Antibody

Sign In for Pricing
View Details
Human Protein Phosphatase 1A (PPM1A, PP2C-alpha) Antibody
32124-05111 150 µg

Human Protein Phosphatase 1A (PPM1A, PP2C-alpha) Antibody

Sign In for Pricing
View Details
Anti-ELK1 Antibody Picoband®, Dylight550 Conjugate
A01426-1-Dylight550 100 µg

Anti-ELK1 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details