Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus carnosus ATP synthase subunit a (atpB)

This Recombinant Staphylococcus carnosus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B9DMF0

Expression Region

1-241

Origin

Staphylococcus carnosus (strain TM300)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQHKSPVVTWDLFGLDIKFNLASILMVIITSLIVLVIAIACTRNLQKRPTGKQNFIEWVF DFVRGIIESNLAWKKGGQFHFLTVTLILFIFVGNMLGLPFAIVIDHTLWWKSPTADATVT LTLATMVILLTHYYGIKMRGTKNYFKNYGQPFLALTPVNIFEEFTNTLTLGLRLYGNIYA GEILIGLLSSLIIGHAAWGWIIGVPGLIAWQAFSIFIGTIQAYIFIMLSMVYMSHKIADD H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD89 Mouse mAb
orb2716929-01 50 µL

CD89 Mouse mAb

Sign In for Pricing
View Details
CD89 Mouse mAb
orb2716929-02 100 µL

CD89 Mouse mAb

Sign In for Pricing
View Details
O52E8 Polyclonal Antibody
RA33735-01 50 µL

O52E8 Polyclonal Antibody

Sign In for Pricing
View Details
O52E8 Polyclonal Antibody
RA33735-02 100 µL

O52E8 Polyclonal Antibody

Sign In for Pricing
View Details
Rat Thyroid-Peroxidase, TPO ELISA Kit
CK-bio-15412-01 48 Tests

Rat Thyroid-Peroxidase, TPO ELISA Kit

Sign In for Pricing
View Details
Rat Thyroid-Peroxidase, TPO ELISA Kit
CK-bio-15412-02 96 Tests

Rat Thyroid-Peroxidase, TPO ELISA Kit

Sign In for Pricing
View Details