Recombinant Staphylococcus carnosus ATP synthase subunit a (atpB)
This Recombinant Staphylococcus carnosus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.
Product Specifications
Product Name Alternative
ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6
UniProt
B9DMF0
Expression Region
1-241
Origin
Staphylococcus carnosus (strain TM300)
Field of Research
Immunology & Inflammation; Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MQHKSPVVTWDLFGLDIKFNLASILMVIITSLIVLVIAIACTRNLQKRPTGKQNFIEWVF DFVRGIIESNLAWKKGGQFHFLTVTLILFIFVGNMLGLPFAIVIDHTLWWKSPTADATVT LTLATMVILLTHYYGIKMRGTKNYFKNYGQPFLALTPVNIFEEFTNTLTLGLRLYGNIYA GEILIGLLSSLIIGHAAWGWIIGVPGLIAWQAFSIFIGTIQAYIFIMLSMVYMSHKIADD H
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
123778-ML750 100 µL
B3GNT3 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3, BGnT-3, Beta-1,3-Gn-T3, Beta-1,3-N-acetylglucosaminyltransferase 3, Beta3Gn-T3, Beta-1,3-galactosyltransferase 8, Beta-1,3-GalTase 8, Beta3Gal-T8, Beta3GalT8, b3Gal-T8, Beta-3-Gx-T8, Core 1 Extending beta-1,3-N-acetylglucosaminyltransferase, Core1-beta3GlcNAcT, Transmembrane Protein 3, UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 8, UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 8, B3GALT8, TMEM3, UNQ637/PRO1266) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
302792-HRP 200 µL
Tfap2c (Transcription Factor AP-2 gamma, AP2-gamma, AP-22, Activating Enhancer-Binding Protein 2 gamma, Tfap2c, Tcfap2c) (HRP) discontinued
Sign In for Pricing
View Details 