Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens Cobalamin synthase (cobS)

This Recombinant Pseudomonas fluorescens Cobalamin synthase (cobS) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C3K0Y6

Expression Region

1-242

Origin

Pseudomonas fluorescens (strain SBW25)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPFWIALQFLSSLPIRLPGMPQPQELGRSLLFYPVVGVLFGVLLWALSTALMGAPLLLH AALLLTAWVLLSGGLHLDGLADSADAWLGGFGDRERTLAIMKDPRSGPIAVVTLGLVLLL KFTALVALIEQQNGAALILAPLIGRASMLALFLTTRYVRAGGLGQALSDHLPRIVGQQVL ILSGLACILIGGFSGGVAVLLAAICFIGLRQLMVNRLGGTTGDTAGALLELLEVAVLVGL AL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MRGRE full length protein-synthetic nanodisc
E33F100350 10 µg

Human MRGRE full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human T-cell leukemia/lymphoma protein 1B, TCL1B ELISA Kit
MBS9338397-01 48 Well

Human T-cell leukemia/lymphoma protein 1B, TCL1B ELISA Kit

Sign In for Pricing
View Details
Human T-cell leukemia/lymphoma protein 1B, TCL1B ELISA Kit
MBS9338397-02 96 Well

Human T-cell leukemia/lymphoma protein 1B, TCL1B ELISA Kit

Sign In for Pricing
View Details
Human T-cell leukemia/lymphoma protein 1B, TCL1B ELISA Kit
MBS9338397-03 5x 96 Well

Human T-cell leukemia/lymphoma protein 1B, TCL1B ELISA Kit

Sign In for Pricing
View Details
Human T-cell leukemia/lymphoma protein 1B, TCL1B ELISA Kit
MBS9338397-04 10x 96 Well

Human T-cell leukemia/lymphoma protein 1B, TCL1B ELISA Kit

Sign In for Pricing
View Details
Sotiburafusp alfa
T81125-01 5 mg

Sotiburafusp alfa

Sign In for Pricing
View Details