Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens Cobalamin synthase (cobS)

This Recombinant Pseudomonas fluorescens Cobalamin synthase (cobS) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C3K0Y6

Expression Region

1-242

Origin

Pseudomonas fluorescens (strain SBW25)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPFWIALQFLSSLPIRLPGMPQPQELGRSLLFYPVVGVLFGVLLWALSTALMGAPLLLH AALLLTAWVLLSGGLHLDGLADSADAWLGGFGDRERTLAIMKDPRSGPIAVVTLGLVLLL KFTALVALIEQQNGAALILAPLIGRASMLALFLTTRYVRAGGLGQALSDHLPRIVGQQVL ILSGLACILIGGFSGGVAVLLAAICFIGLRQLMVNRLGGTTGDTAGALLELLEVAVLVGL AL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Qdot 800 10 umol scale
26-6939-10 1 Each

Qdot 800 10 umol scale

Sign In for Pricing
View Details
ELAV-like protein 1 Antibody (Fluoro550)
orb3156176 100 µg

ELAV-like protein 1 Antibody (Fluoro550)

Sign In for Pricing
View Details
Anti-Cytokeratin 8/KRT8 Antibody Picoband® (FITC Conjugate)
A01421-FITC 100 µg/Vial

Anti-Cytokeratin 8/KRT8 Antibody Picoband® (FITC Conjugate)

Sign In for Pricing
View Details
Tbxa2r (NM_017054) Rat Tagged ORF Clone
RR211531 10 µg

Tbxa2r (NM_017054) Rat Tagged ORF Clone

Sign In for Pricing
View Details
HOXB7 (Homeobox B7, HHO.C1, HOX2, HOX2C, Hox-2.3) (HRP)
247222-HRP 100 µL

HOXB7 (Homeobox B7, HHO.C1, HOX2, HOX2C, Hox-2.3) (HRP)

Sign In for Pricing
View Details
Procyanidin A2
GY2840-5mg 5 mg

Procyanidin A2

Sign In for Pricing
View Details