Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis ATP synthase subunit a (atpB)

This Recombinant Staphylococcus epidermidis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q5HMB3

Expression Region

1-242

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKSPLVSWNVFGFDIVFNLASVLMVVITAILVFILAIVCTRNLKKRPTGKQNFIEWVF DFVRGIIESNMAWKKGGNFHFLAVTLILFIFVANMLGLPFAIVTHDHTLWWKSPTADATV TLTLSTTMILLTHYYGIKMRGTKAYAAGYFKPFWPLAIINVFEEFTSTLTLGLRLYGNIF AGELLLGLLASLFFEQPAWGWIISIPGLIVWQAFSIFVGTIQAYIFVMLSMVYMSHKVAD GH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCDC183 siRNA
abx910593-01 15 nmol

Human CCDC183 siRNA

Sign In for Pricing
View Details
Human CCDC183 siRNA
abx910593-02 30 nmol

Human CCDC183 siRNA

Sign In for Pricing
View Details
CLIP1 Antibody
A73944-50UL 50 μL

CLIP1 Antibody

Sign In for Pricing
View Details
E/E061/NT/VPVC-PHOLUMC-151X151-1 V-shape & L-shape Signs
238132 1 Pack (1 Panel (s) x 1 Pack)

E/E061/NT/VPVC-PHOLUMC-151X151-1 V-shape & L-shape Signs

Sign In for Pricing
View Details
Recombinant Rabbit ANGPT2 Protein (aa 230-487) [His] [T7]
VAng-3089Lsx-500g 500 µg

Recombinant Rabbit ANGPT2 Protein (aa 230-487) [His] [T7]

Sign In for Pricing
View Details
Deoxythymidylate Kinase (DTYMK) Polyclonal Antibody
CAU23098-01 100 µL

Deoxythymidylate Kinase (DTYMK) Polyclonal Antibody

Sign In for Pricing
View Details