Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis ATP synthase subunit a (atpB)

This Recombinant Staphylococcus epidermidis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q5HMB3

Expression Region

1-242

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKSPLVSWNVFGFDIVFNLASVLMVVITAILVFILAIVCTRNLKKRPTGKQNFIEWVF DFVRGIIESNMAWKKGGNFHFLAVTLILFIFVANMLGLPFAIVTHDHTLWWKSPTADATV TLTLSTTMILLTHYYGIKMRGTKAYAAGYFKPFWPLAIINVFEEFTSTLTLGLRLYGNIF AGELLLGLLASLFFEQPAWGWIISIPGLIVWQAFSIFVGTIQAYIFVMLSMVYMSHKVAD GH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli Protein hdeD (hdeD)
MBS1043165 Inquire

Recombinant Escherichia coli Protein hdeD (hdeD)

Sign In for Pricing
View Details
Lamin A/C Polyclonal Antibody, Cy5.5 Conjugated
bs-41239R-Cy5.5 100 µL

Lamin A/C Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Pafolacianine
T39103 25 mg

Pafolacianine

Sign In for Pricing
View Details
EPH A2, A3, A4, A5, Phosphorylated (Tyr 596/602) (Ephrin Type-A Receptor) (MaxLight 750) discontinued
217340-ML750 100 µL

EPH A2, A3, A4, A5, Phosphorylated (Tyr 596/602) (Ephrin Type-A Receptor) (MaxLight 750) discontinued

Sign In for Pricing
View Details
ATP5G1 siRNA (Rat)
CRR1365-01 15 nmol

ATP5G1 siRNA (Rat)

Sign In for Pricing
View Details
ATP5G1 siRNA (Rat)
CRR1365-02 30 nmol

ATP5G1 siRNA (Rat)

Sign In for Pricing
View Details