Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)

This Recombinant Staphylococcus aureus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q5HE91

Expression Region

1-242

Origin

Staphylococcus aureus (strain COL)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATV TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVAD EH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIRC16 Protein Vector (Human) (pPB-N-His)
PV111199 500 ng

PIRC16 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Neokurarinol
TBW01090 2mg

Neokurarinol

Sign In for Pricing
View Details
PASD1 ORF Vector (Human) (pORF)
36047011 1.0 µg DNA

PASD1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Auts2 3'UTR GFP Stable Cell Line
TU152412 1.0 mL

Auts2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Bcl-2 Rabbit Polyclonal Antibody
ER0602 100 µL

Bcl-2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DLG2 antibody - N-terminal region (ARP43637_P050)
ARP43637_P050 100 µL

DLG2 antibody - N-terminal region (ARP43637_P050)

Sign In for Pricing
View Details